min=17 | max=33 | html | | plain_text | %3Ecds2_8073-9212%0D%0AMEKLARTLVPEYLKDLKVYQAGKPIDEVAREKGLTKISKLASNENPLGPSPYAIKEMTGG%0D%0ALWDLHRYPDMHAFQLKKSLCGLYSLEPGNIILGNGSEGIMAYIARAFLQPGDEVLTCENT%0D%0AFIGFYILARSVGANLKKVPLTSDYRFDVEALAKSITSKTKAIYIANPNNPTGTYITKKEF%0D%0ADYLMEYVPDHVIVLLDEAYFEFAKDCDDYPDSMDYRYDNVITLRTFSKAYGLSGIRVGYG%0D%0AFAHDELISNLSKVKLPFEPNLIGQLGAKGALNDTPHLSRTLKNNKKRYNETFDFLTKHDF%0D%0ANPIKSITNFITYKTGSLEASEWMFENLLNEGVIIRPLKANEMPEYVRVSLGNKEEMQHYF%0D%0AEAMVKILPKYNDLFGRPTK%0D%0A
Inside to outside helices : 2 found from to score center 84 ( 84) 107 ( 103) 17 94 120 ( 120) 138 ( 136) 83 128 Outside to inside helices : 2 found from to score center 84 ( 87) 107 ( 107) 129 95 116 ( 116) 138 ( 135) 104 127
Helices shown in brackets are considered insignificant.
A "+"-symbol indicates a preference of this orientation.
A "++"-symbol indicates a strong preference of this orientation.
inside->outside | outside->inside ( 84- 107 (24) 17 ) |( 84- 107 (24) 129 + ) ( 120- 138 (19) 83 ) |( 116- 138 (23) 104 )
2 possible models considered, only significant TM-segments used !!! probably no transmembrane protein - no possible model found !!!
You can get the prediction graphics shown above in one of the following formats: